>Entire sequence for 12e8_VH_H
EVQLQQSGAEVVRSGASVKLSCTASGFNIKDYYIHWVKQRPEKGLEWIGWIDPEIGDTEYVPKFQGKATMTADTSSNTAYLQLSSLTSEDTAVYYCNAGHDYDRGRFPYWGQGTLVTVSA
>12e8_VH_H CDR1:
GFNIKDY
>12e8_VH_H CDR2:
DPEIGD
>12e8_VH_H CDR3:
GHDYDRGRFPY