>Entire sequence for 12e8_VH_P
EVQLQQSGAEVVRSGASVKLSCTASGFNIKDYYIHWVKQRPEKGLEWIGWIDPEIGDTEYVPKFQGKATMTADTSSNTAYLQLSSLTSEDTAVYYCNAGHDYDRGRFPYWGQGTLVTVSA
>12e8_VH_P CDR1:
GFNIKDY
>12e8_VH_P CDR2:
DPEIGD
>12e8_VH_P CDR3:
GHDYDRGRFPY