>Entire sequence for 12e8_VL_L
DIVMTQSQKFMSTSVGDRVSITCKASQNVGTAVAWYQQKPGQSPKLMIYSASNRYTGVPDRFTGSGSGTDFTLTISNMQSEDLADYFCQQYSSYPLTFGAGTKLELKRA
>12e8_VL_L CDR1:
KASQNVGTAVA
>12e8_VL_L CDR2:
SASNRYT
>12e8_VL_L CDR3:
QQYSSYPLT