>Entire sequence for 12e8_VL_M
DIVMTQSQKFMSTSVGDRVSITCKASQNVGTAVAWYQQKPGQSPKLMIYSASNRYTGVPDRFTGSGSGTDFTLTISNMQSEDLADYFCQQYSSYPLTFGAGTKLELKRA
>12e8_VL_M CDR1:
KASQNVGTAVA
>12e8_VL_M CDR2:
SASNRYT
>12e8_VL_M CDR3:
QQYSSYPLT