>Entire sequence for 1ahw_VH_B
EIQLQQSGAELVRPGALVKLSCKASGFNIKDYYMHWVKQRPEQGLEWIGLIDPENGNTIYDPKFQGKASITADTSSNTAYLQLSSLTSEDTAVYYCARDNSYYFDYWGQGTTLTVSS
>1ahw_VH_B CDR1:
GFNIKDY
>1ahw_VH_B CDR2:
DPENGN
>1ahw_VH_B CDR3:
DNSYYFDY