>Entire sequence for 1ahw_VH_E
EIQLQQSGAELVRPGALVKLSCKASGFNIKDYYMHWVKQRPEQGLEWIGLIDPENGNTIYDPKFQGKASITADTSSNTAYLQLSSLTSEDTAVYYCARDNSYYFDYWGQGTTLTVSS
>1ahw_VH_E CDR1:
GFNIKDY
>1ahw_VH_E CDR2:
DPENGN
>1ahw_VH_E CDR3:
DNSYYFDY