>Entire sequence for 1ahw_VL_A
DIKMTQSPSSMYASLGERVTITCKASQDIRKYLNWYQQKPWKSPKTLIYYATSLADGVPSRFSGSGSGQDYSLTISSLESDDTATYYCLQHGESPYTFGGGTKLEINRAD
>1ahw_VL_A CDR1:
KASQDIRKYLN
>1ahw_VL_A CDR2:
YATSLAD
>1ahw_VL_A CDR3:
LQHGESPYT