>Entire sequence for 1ahw_VL_D
DIKMTQSPSSMYASLGERVTITCKASQDIRKYLNWYQQKPWKSPKTLIYYATSLADGVPSRFSGSGSGQDYSLTISSLESDDTATYYCLQHGESPYTFGGGTKLEINRAD
>1ahw_VL_D CDR1:
KASQDIRKYLN
>1ahw_VL_D CDR2:
YATSLAD
>1ahw_VL_D CDR3:
LQHGESPYT