>Entire sequence for 1hh6_VH_B
QDQLQQSGAELVRPGASVKLSCKALGYIFTDYEIHWVKQTPVHGLEWIGGIHPGSSGTAYNQKFKGKATLTADKSSTTAFMELSSLTSEDSAVYYCTRKDYWGQGTLVTVSA
>1hh6_VH_B CDR1:
GYIFTDY
>1hh6_VH_B CDR2:
HPGSSG
>1hh6_VH_B CDR3:
KDY