>Entire sequence for 1hh9_VL_A
DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRA
>1hh9_VL_A CDR1:
KASQDINSFLT
>1hh9_VL_A CDR2:
RANRLMI
>1hh9_VL_A CDR3:
LQYDDFPLT