>Entire sequence for 2r56_VH_H
QVSLRESGGGLVQPGRSLRLSCTASGFTFRHHGMTWVRQAPGKGLEWVASLSGSGTKTHFADSVKGRFTISRDNSNNTLYLQMDNVRDEDTAIYYCAKAKRVGATGYFDLWGRGTLVTVSS
>2r56_VH_H CDR1:
GFTFRHH
>2r56_VH_H CDR2:
SGSGTK
>2r56_VH_H CDR3:
AKRVGATGYFDL