>Entire sequence for 2r56_VH_I
QVSLRESGGGLVQPGRSLRLSCTASGFTFRHHGMTWVRQAPGKGLEWVASLSGSGTKTHFADSVKGRFTISRDNSNNTLYLQMDNVRDEDTAIYYCAKAKRVGATGYFDLWGRGTLVTVSS
>2r56_VH_I CDR1:
GFTFRHH
>2r56_VH_I CDR2:
SGSGTK
>2r56_VH_I CDR3:
AKRVGATGYFDL