>Entire sequence for 2r56_VL_L
DIVMTQSPSSLSASVGDRVTITCRASQGISSRLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYHSYPWTFGQGTKLEIKRTV
>2r56_VL_L CDR1:
RASQGISSRLA
>2r56_VL_L CDR2:
AASSLQS
>2r56_VL_L CDR3:
QQYHSYPWT