>Entire sequence for 2r56_VL_M
DIVMTQSPSSLSASVGDRVTITCRASQGISSRLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQYHSYPWTFGQGTKLEIKRTV
>2r56_VL_M CDR1:
RASQGISSRLA
>2r56_VL_M CDR2:
AASSLQS
>2r56_VL_M CDR3:
QQYHSYPWT