>Entire sequence for 3eo1_VH_B
QVQLVQSGAEVKKPGSSVKVSCKASGYTFSSNVISWVRQAPGQGLEWMGGVIPIVDIANYAQRFKGRVTITADESTSTTYMELSSLRSEDTAVYYCASTLGLVLDAMDYWGQGTLVTVSS
>3eo1_VH_B CDR1:
GYTFSSN
>3eo1_VH_B CDR2:
IPIVDI
>3eo1_VH_B CDR3:
TLGLVLDAMDY