>Entire sequence for 3eo1_VH_E
QVQLVQSGAEVKKPGSSVKVSCKASGYTFSSNVISWVRQAPGQGLEWMGGVIPIVDIANYAQRFKGRVTITADESTSTTYMELSSLRSEDTAVYYCASTLGLVLDAMDYWGQGTLVTVSS
>3eo1_VH_E CDR1:
GYTFSSN
>3eo1_VH_E CDR2:
IPIVDI
>3eo1_VH_E CDR3:
TLGLVLDAMDY