>Entire sequence for 3eo1_VL_A
ETVLTQSPGTLSLSPGERATLSCRASQSLGSSYLAWYQQKPGQAPRLLIYGASSRAPGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYADSPITFGQGTRLEIKRTV
>3eo1_VL_A CDR1:
RASQSLGSSYLA
>3eo1_VL_A CDR2:
GASSRAP
>3eo1_VL_A CDR3:
QQYADSPIT