>Entire sequence for 3eo1_VL_D
ETVLTQSPGTLSLSPGERATLSCRASQSLGSSYLAWYQQKPGQAPRLLIYGASSRAPGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYADSPITFGQGTRLEIKRTV
>3eo1_VL_D CDR1:
RASQSLGSSYLA
>3eo1_VL_D CDR2:
GASSRAP
>3eo1_VL_D CDR3:
QQYADSPIT