>Entire sequence for 3eoa_VL_A
DIQMTQSPSSLSASVGDRVTITCRASKTISKYLAWYQQKPGKAPKLLIYSGSTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHNEYPLTFGQGTKVEIKRTV
>3eoa_VL_A CDR1:
RASKTISKYLA
>3eoa_VL_A CDR2:
SGSTLQS
>3eoa_VL_A CDR3:
QQHNEYPLT