>Entire sequence for 3eoa_VL_L
DIQMTQSPSSLSASVGDRVTITCRASKTISKYLAWYQQKPGKAPKLLIYSGSTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHNEYPLTFGQGTKVEIKRTV
>3eoa_VL_L CDR1:
RASKTISKYLA
>3eoa_VL_L CDR2:
SGSTLQS
>3eoa_VL_L CDR3:
QQHNEYPLT