>Entire sequence for 3eob_VL_A
DIQMTQSPSSLSASVGDRVTITCRASKTISKYLAWYQQKPGKAPKLLIYSGSTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHNEYPLTFGQGTKVEIKRTV
>3eob_VL_A CDR1:
RASKTISKYLA
>3eob_VL_A CDR2:
SGSTLQS
>3eob_VL_A CDR3:
QQHNEYPLT