>Entire sequence for 3eob_VL_L
DIQMTQSPSSLSASVGDRVTITCRASKTISKYLAWYQQKPGKAPKLLIYSGSTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQHNEYPLTFGQGTKVEIKRTV
>3eob_VL_L CDR1:
RASKTISKYLA
>3eob_VL_L CDR2:
SGSTLQS
>3eob_VL_L CDR3:
QQHNEYPLT