>Entire sequence for 3k2u_VH_H
EVQLVESGGGLVQPGGSLRLSCAASGFTINGTYIHWVRQAPGKGLEWVGGIYPAGGATYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAKWWAWPAFDYWGQGTLVTVSS
>3k2u_VH_H CDR1:
GFTINGT
>3k2u_VH_H CDR2:
YPAGGA
>3k2u_VH_H CDR3:
WWAWPAFDY