>Entire sequence for 3k2u_VL_L
DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSNRAPATFGQGTKVEIKRTV
>3k2u_VL_L CDR1:
RASQDVSTAVA
>3k2u_VL_L CDR2:
SASFLYS
>3k2u_VL_L CDR3:
QQSNRAPAT