Completionist Model Completion for Membrane, Soluble and Ig-like Proteins

 

For Academic Use Only
 

1

Complete target sequence:

Paste your amino acid sequence into the following text field:

Please input a pure sequence, containing only amino acid letters and NOT a
FASTA-formatted sequence. For example, the sequence of PDB entry 2JAFA:
AVRENALLSSSLWVNVALAGIAILVFVYMGRTIRPGRPRLIWGATLMIPLVSISSYLGLL
SGLTVGMIEMPAGHALAGEMVRSQWGRYLTWALSTPMILLALGLLADVDLGSLFTVIAAD
IGMCVTGLAAAMTTSALLFRWAFYAISCAFFVVVLSALVTDWAASASSAGTAEIFDTLRV
LVVVLWLGYPIVWAVGVEGLALVQSVGATSWAYSVLDVFAKYVFAFILLRWVANNERTVA
VA
2

Incomplete model structure:

How would you like to provide your protein structure (PDB, one chain only)?

Choose a file to upload from your hard drive:

Example input file, an incomplete model of PDB entry 2JAFA
3

Options:

Protein type (used to select a FREAD fragment database):

4

Submit:

Please press the submit button once only - uploading takes time. Thank you.

Already have a result ID? You can review your previous results.

Struggling? Have a look at the Help page.

View an example result.