SAbPred: ANARCI

Antigen receptor Numbering And Receptor ClassificatIon.

ANARCI is a tool for numbering amino-acid sequences of antibody and T-cell receptor variable domains.
Use the form below to identify domains and annotate them with either the IMGT, Chothia, Kabat, Martin (Enhanced Chothia) or AHo numbering scheme.
TCR sequences can only be numbered with IMGT or AHo schemes.
ANARCI aligns a given sequence to a database of Hidden Markov Models that describe the germline sequences of antibody and TCR domain types.
The most significant alignment predicts the domain type and species of the input sequence.

ANARCI is freely available to download for all users.

Submit single sequence:

load example

or upload multiple sequences as a fasta file:

Choose a numbering scheme:

IMGT Kabat Chothia Martin AHo

Choose an output format:

Comma separated value (csv) file (horizontal format) Plain text (txt) file (vertical format)

Restrict to immunoglobulin domains only

A Python 3 version of ANARCI is now available from the OPIG Github.
ANARCI is freely available for all users.
It runs on Linux and OSX.
If you would like to be kept informed about new releases of the software, please fill out the form below.

﹡Email address:

﹡Institution:

Dependencies

Installation

tar -zxvf anarci-1.3.tar.gz

cd anarci-1.3

python setup.py install

Users without root permissions can use either of the following commands instead:

python setup.py install --user

python setup.py install --home="~"

During setup, ANARCI will automatically download the latest set of germline genes from IMGT.
For more information see the INSTALL file.

Usage

ANARCI --scheme chothia -i EVQLQQSGAEVVRSGASVKLSCTASGFNIKDYYIHWVKQRPEKGLEWIGWIDPEIGDTEYVPKFQGKATMTADTSSNTAYLQLSS...

...LTSEDTAVYYCNAGHDYDRGRFPYWGQGTLVTVSA