Thera-SAbDab

DENOSUMAB

> Structural Summary

Therapeutic	Denosumab
Target	TNFSF11
Heavy Chain	EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSGITGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPGTTVIMSWFDPWGQGTLVTVSS
Light Chain	EIVLTQSPGTLSLSPGERATLSCRASQSVRGRYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVFYCQQYGSSPRTFGQGTKVEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G2
Highest Clinical Trial (Aug '22)	Approved
Estimated Status (Aug '22)	Active
Recorded Developmental Technology	Abgenix XenoMouse
INN Year Proposed	2005
INN Year Recommended	2006
Companies Involved	Amgen, Daiichi Sankyo Company, European Thoracic Oncology Platform, GlaxoSmithKline, Jules Bordet Institute, Melbourne Health, University Health Network
Conditions Approved	Bone cancer, Bone disorders, Bone metastases, Corticosteroid-induced osteoporosis, Male osteoporosis, Malignant hypercalcaemia, Osteoporosis, Postmenopausal osteoporosis, Rheumatoid arthritis
Conditions Active	Breast cancer, Non-small cell lung cancer, Osteogenesis imperfecta, Malignant melanoma
Conditions Discontinued	Multiple myeloma
Notes

SAbDab papers

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]

Thera-SAbDab paper

Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]

Our privacy policy