| Therapeutic | Tralokinumab |
| Target | IL13 |
| Heavy Chain | QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGLSWVRQAPGQGLEWMGWISANNGDTNYGQEFQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDSSSSWARWFFDLWGRGTLVTVSS |
| Light Chain | SYVLTQPPSVSVAPGKTARITCGGNIIGSKLVHWYQQKPGQAPVLVIYDDGDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDTGSDPVVFGGGTKLTVL |
| 100% seqID Fv Structure | 5l6y%3AHL [Fvs: ] |
| 99% seqID Fv Structure | None |
| 95-98% seqID Fv Structure | None |
| 100% seqID Structure | 5l6y%3AHL [Fvs: ] |
Follow these links to our prediction tools:
| Format | Whole mAb |
| Isotype | G4 |
| Highest Clinical Trial (August '23) | Phase-III |
| Estimated Status (August '23) | Active |
| Recorded Developmental Technology | na |
| INN Year Proposed | 2009 |
| INN Year Recommended | 2010 |
| Companies Involved | Cambridge Antibody Technology%3BIcahn School of Medicine at Mount Sinai%3BLEO Pharma%3BMedImmune |
| Conditions Approved | na |
| Conditions Active | Atopic dermatitis%3BAlopecia areata |
| Conditions Discontinued | Asthma%3BChronic obstructive pulmonary disease%3BIdiopathic pulmonary fibrosis%3BUlcerative colitis |
| Notes |
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]
Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]
