Thera-SAbDab

RIVABAZUMAB

> Structural Summary

Therapeutic	Rivabazumab
Target	PcrV type III secretion system
Heavy Chain	EVQLVESGGGVVQPGRSLRLSCAASGFTFSNYPMHWVRQAPGKGLEWVAVISYDGSEKWYADSVKGRFTISRDNSKNTLYLEMNSLRPEDTAVYYCARNRGDIYYDFTYAMDIWGQGTTVTVSS
Light Chain	DIQLTQSPSTLSASVGDSVTITCRASEGVDRWLAWYQQKPGRAPKLLIYDASTLQSGVPSRFSGSGSGTEFSLTISSLQPDDVATYYCQHFWGTPYTFGQGTKLEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Fab
Isotype	G1
Highest Clinical Trial (August '23)	Phase-II
Estimated Status (August '23)	Discontinued
Recorded Developmental Technology	Humaneering Technology
INN Year Proposed	2015
INN Year Recommended	2016
Companies Involved	KaloBios Pharmaceuticals Inc
Conditions Approved	na
Conditions Active	na
Conditions Discontinued	Infectiology%3BInflammation%3BInherited diseases
Notes

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]

Our privacy policy