Detailed entry information.
Click on any of the tabs below to see the detailed information about the structure.
Human Pre-T Cell Receptor Crystal Structure
Item | Info |
---|---|
PDB | 3of6 |
Organism | HOMO SAPIENS |
Method | X-RAY DIFFRACTION |
Resolution | 2.8Å |
Number of TCRs | 3 |
This PDB has 3 TCR(s).
Item | Info |
---|---|
VB chain | A |
VB IMGT details | TRBV7/TRBJ2 |
Species | human |
Chain type | Chain ID | FASTA/Annotation file | IMGT numbered sequence (Framework/CDR) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
VB | A | FASTA file |
|
Loop | Sequence | Predicted canonical form | CDR Length |
---|---|---|---|
CDRB3 | ASSLGQAYEQY | None | 11 |
CDRB2 | FQNEAQ | None | 6 |
CDRB1 | SGHVS | None | 5 |
Item | Info |
---|---|
VB chain | B |
VB IMGT details | TRBV7/TRBJ2 |
Species | human |
Item | Info |
---|---|
Antigen Chain | F |
Antigen Type | Protein |
Antigen Organism | HOMO SAPIENS |
Antigen Sequence | GAHMLPTGVGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDSPIWFSAGNGSALDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTGPGAEGHSRSTQPMHLSGEASTARTCSGDDDDK |
Antigen Length | 130 |
Chain type | Chain ID | FASTA/Annotation file | IMGT numbered sequence (Framework/CDR) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
VB | B | FASTA file |
|
Loop | Sequence | Predicted canonical form | CDR Length |
---|---|---|---|
CDRB3 | ASSLGQAYEQY | None | 11 |
CDRB2 | FQNEAQ | None | 6 |
CDRB1 | SGHVS | None | 5 |
Item | Info |
---|---|
VB chain | C |
VB IMGT details | TRBV7/TRBJ2 |
Species | human |
Item | Info |
---|---|
Antigen Chain | E |
Antigen Type | Protein |
Antigen Organism | HOMO SAPIENS |
Antigen Sequence | GAHMLPTGVGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDSPIWFSAGNGSALDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTGPGAEGHSRSTQPMHLSGEASTARTCSGDDDDK |
Antigen Length | 130 |
Chain type | Chain ID | FASTA/Annotation file | IMGT numbered sequence (Framework/CDR) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
VB | C | FASTA file |
|
Loop | Sequence | Predicted canonical form | CDR Length |
---|---|---|---|
CDRB3 | ASSLGQAYEQY | None | 11 |
CDRB2 | FQNEAQ | None | 6 |
CDRB1 | SGHVS | None | 5 |