Therapeutic | Tralokinumab |
Target | IL13 |
Heavy Chain | QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGLSWVRQAPGQGLEWMGWISANNGDTNYGQEFQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDSSSSWARWFFDLWGRGTLVTVSS |
Light Chain | SYVLTQPPSVSVAPGKTARITCGGNIIGSKLVHWYQQKPGQAPVLVIYDDGDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDTGSDPVVFGGGTKLTVL |
100% seqID Fv Structure | 5l6y%3AHL [Fvs: ] |
99% seqID Fv Structure | None |
95-98% seqID Fv Structure | None |
100% seqID Structure | 5l6y%3AHL [Fvs: ] |
Follow these links to our prediction tools:
Format | Whole mAb |
Isotype | G4 |
Highest Clinical Trial (August '23) | Approved |
Estimated Status (August '23) | Active |
Recorded Developmental Technology | na |
INN Year Proposed | 2009 |
INN Year Recommended | 2010 |
Companies Involved | Cambridge Antibody Technology%3BIcahn School of Medicine at Mount Sinai%3BLEO Pharma%3BMedImmune |
Conditions Approved | na |
Conditions Active | Atopic dermatitis%3BAlopecia areata |
Conditions Discontinued | Asthma%3BChronic obstructive pulmonary disease%3BIdiopathic pulmonary fibrosis%3BUlcerative colitis |
Notes |
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]
Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]