| Therapeutic | Envafolimab |
| Target | PDL1 |
| Heavy Chain | QVQLVESGGGLVQPGGSLRLSCAASGKMSSRRCMAWFRQAPGKERERVAKLLTTSGSTYLADSVKGRFTISRDNSKNTVYLQMNSLRAEDTAVYYCAADSFEDPTCTLVTSSGAFQYWGQGTLVTVSS |
| Light Chain | na |
| 100% seqID Fv Structure | None |
| 99% seqID Fv Structure | None |
| 95-98% seqID Fv Structure | None |
Follow these links to our prediction tools:
| Format | Single Domain Variable Fragment;H |
| Isotype | G1 |
| Highest Clinical Trial (August '23) | Approved |
| Estimated Status (August '23) | Active |
| Recorded Developmental Technology | na |
| INN Year Proposed | 2018 |
| INN Year Recommended | 2019 |
| Companies Involved | Alphamab, 3D Medicines, Sun Yat-Sen University |
| Conditions Approved | Solid tumours |
| Conditions Active | Biliary cancer, Breast cancer, Gastric cancer, Gastrointestinal cancer, Hepatitis B, Malignant fibrous histiocytoma, Soft tissue sarcoma |
| Conditions Discontinued | na |
| Notes | (Oct '22) Sequence fixed to contain the full DJ/J regions. |
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]
Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]
