Thera-SAbDab

ENGLUMAFUSP

> Structural Summary

Therapeutic	Englumafusp
Target	CD19
Heavy Chain	QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYIMHWVRQAPGQGLEWMGYINPYNDGSKYTEKFQGRVTMTSDTSISTAYMELSRLRSDDTAVYYCARGTYYYGPQLFDYWGQGTTVTVSS
Light Chain	DIVMTQTPLSLSVTPGQPASISCKSSQSLETSTGTTYLNWYLQKPGQSPQLLIYRVSKRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQLLEDPYTFGQGTKLEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Fusion Protein
Isotype	G1
Highest Clinical Trial (August '23)	Phase-I
Estimated Status (August '23)	Active
Recorded Developmental Technology	na
INN Year Proposed	2021
INN Year Recommended	2022
Companies Involved	Roche
Conditions Approved	na
Conditions Active	B cell Lymphoma
Conditions Discontinued	na
Notes	(June '22: Corrected CDRH2 sequence. Aug '22: WHO changed name from ensomafusp to englumafusp in PL127)

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]

Our privacy policy