>   Entry details
Reference title Delta SARS-CoV-2 spike protein in complex with REGN10987 Fab homologue
Reference authors Pichkur,E.B.;Lyukmanova,E.N.;Shenkarev,Z.O.
Reference URL https://opig.stats.ox.ac.uk/webapps/newsabdab/sabdab/structureviewer/?pdb=7zjl
Heavy chain QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAMYWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRTEDTAVYYCASGSDYGDYLLVYWGQGTLVTVSS
Light chain QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSKRPSGVSNRFSGSKSGNTASLTISGLQSEDEADYYCNSLTSISTWVFGGGTKLTVL
Heavy chain definition Delta Sars-Cov-2 Spike Protein In Complex With Regn10987 Fab Homologue.
Light chain definition Delta Sars-Cov-2 Spike Protein In Complex With Regn10987 Fab Homologue.
Organism homo sapiens
Targets mentioned SARS-CoV-2
Update date 19-APR-2023
>   Model viewer

The model in display was generated with ABodyBuilder2, which is part of ImmuneBuilder
Display options:




Color options:

>   Downloads
IMGT-numbered model structure Download
Summary file for this entry Download

Brennan Abanades et al. “The Patent and Literature Antibody Database (PLAbDab):
an evolving reference set of functionally diverse, literature-annotated antibody sequences and structures”. In: Nucleic Acids Research, Volume 52, Issue D1, 5 January 2024, Pages D545-D551 [ link]

Download BibTex Reference

Header image credit: David Goodsell