| Therapeutic | Gacovetug |
| Target | F4+ ETEC (Veterinary Application) |
| Heavy Chain | QVQLQESGGGLVQPGGSLRLSCTASGSISSINAMGWYRQAPGSKREFVAHITNTGVTEFADSVKGRFTISRDNAKTTVDLQMNSLKPEDTAVYYCAATDWGTLLIKGIDHWGKGTQVTVSS |
| Light Chain | na |
| 100% seqID Fv Structure | 4wen [Fvs: B] |
| 99% seqID Fv Structure | None |
| 95-98% seqID Fv Structure | None |
| 100% seqID Structure | 4wen [Fvs: B] |
Follow these links to our prediction tools:
| Format | Dimerised heavy domain (VH-h-CH2-CH3-CHS dimer) |
| Isotype | A1 |
| Highest Clinical Trial (Feb '25) | TBC |
| Estimated Status (Feb '25) | Active |
| Recorded Developmental Technology | |
| INN Year Proposed | 2024 |
| INN Year Recommended | None |
| Companies Involved | Vrije Universiteit Brussel |
| Conditions Approved | na |
| Conditions Active | Veterinary F4+ E coli Infections |
| Conditions Discontinued | na |
| Notes | anti-[F4+ enterotoxigenic Escherichia coli (ETEC) FaeG (subunit of the major constituent of F4 + fimbriae). Alpaca VHH domain on Sus Scrofa derived heavy chain dimer. |
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]
Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]