| Therapeutic | Gocatamig2 |
| Target | DLL3 |
| Heavy Chain | EVQLVESGGGLVQPGGSLTLSCAASSSSVSLLSLAWYRQAPGKKRELVAGISDDGSIVYMDSVKGRFTISRDNAKNSVYLQMNSLRAEDTAVYYCYAYSWITRSPYWGQGTLVTVSS |
| Light Chain | na |
| 100% seqID Fv Structure | None |
| 99% seqID Fv Structure | None |
| 95-98% seqID Fv Structure | None |
Follow these links to our prediction tools:
| Format | Trispecific Mixed scFv and Single Domains (scFvhl-VH-VH'); Monospecific entry |
| Isotype | na |
| Highest Clinical Trial (Feb '25) | Phase-I/II |
| Estimated Status (Feb '25) | Active |
| Recorded Developmental Technology | |
| INN Year Proposed | 2024 |
| INN Year Recommended | 2024 |
| Companies Involved | Harpoon Therapeutics |
| Conditions Approved | na |
| Conditions Active | Neuroendocrine tumours, Small cell lung cancer |
| Conditions Discontinued | na |
| Notes | Humanised VH: vicpac/homosap. Podentamig Fv1 and Godatamig Fv1 have the same sequence |
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]
Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]
