Thera-SAbDab

LECANKITUG

> Structural Summary

Therapeutic	Lecankitug
Target	IL17A&IL17F
Heavy Chain	QFQLVQSGAEVKKPGASVKVSCKASGYTFTDYNLNWVRQAPGKGLEWMGVIHPDYGTTSYNQKFKDRVTMTVDTSTSTVYMELSSLRSEDTAVYYCVRYDYGDAMDYWGQGTLVTVSS
Light Chain	DIVMTQSPLSLSVTPGQPASISCRSSQSLVHSNGNTYLHWYLQKPGQPPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQSTHVPLTFGQGTKLEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder2.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder2
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G1
Highest Clinical Trial (Feb '25)	TBC
Estimated Status (Feb '25)	TBC
Recorded Developmental Technology	TBC
INN Year Proposed	2025
INN Year Recommended	None
Companies Involved	TBC
Conditions Approved	TBC
Conditions Active	TBC
Conditions Discontinued	TBC
Notes	TBC

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]

Our privacy policy