Thera-SAbDab

LOFACIMIG

> Structural Summary

Therapeutic	Lofacimig
Target 1	F11
Heavy Chain 1	QVQLVESGGGSVQAGGSLRLSCAASGHTYSSNYCMAWFRQAPGKEREGVAAIYSDGSTSYADSVKGRFTISKDNSKNTLYLQMNSLRAEDTAVYYCAATAYEGSWTGKQPLCLLYEYTYWGQGTLVTVSS
Light Chain 1	na
100% seqID Fv 1 Structure	None
99% seqID Fv 1 Structure	None
95-98% seqID Fv 1 Structure	None
Target 2	F11
Heavy Chain 2	QVQLVESGGSVQAGGSLRLSCTASEFTFDDSDMAWYRQAPGNECELVSTITSDGGTYYADSVKGRFTISQDNSKNTMYLQMNSLRAEDTAVYYCAADQWGSAEGDCTSSYPGGYWGQGTLVTVSS
Light Chain 2	na
100% seqID Fv 2 Structure	None
99% seqID Fv 2 Structure	None
95-98% seqID Fv 2 Structure	None

There are currently no PDB structures close in sequence to either Fv of this therapeutic. Click the links to build models with ABodyBuilder2: [Fv 1] [Fv 2]

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder2: [Fv 1] [Fv 2]
Test for possible therapeutic developability issues with TAP: [Fv 1] [Fv 2]
Assign canonical forms by sequence with SCALOP: [Fv 1] [Fv 2]
Number the sequences in any numbering scheme with ANARCI: [Fv 1 H] [Fv 1 L] [Fv 2 H] [Fv 2 L]

Format	Bispecific Tandem VH Domains fused to G1 Constant Domain
Isotype	G1
Highest Clinical Trial (Feb '25)	TBC
Estimated Status (Feb '25)	Active
Recorded Developmental Technology	TBC
INN Year Proposed	2024
INN Year Recommended	None
Companies Involved	TBC
Conditions Approved	TBC
Conditions Active	TBC
Conditions Discontinued	TBC
Notes	Fv1 and Fv2: Humanised from Camel. VH1 binds the Apple-2 domain; VH2 binds the Apple-3 domain.

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]

Our privacy policy