| Therapeutic | Pumitamig2 |
| Target | PDL1/CD274 |
| Heavy Chain | EVQLQESGGGLVQPGGSLRLSCAASGFTFSSYWMYWLRQAPGKGLEWVSSINSDSSSTYYRDSVKGRFTISRDNAKNTLYLQMNSLKSEDTAVYYCAKDPGGYAKGQGTQVTVSS |
| Light Chain | na |
| 100% seqID Fv Structure | 7czd [Fvs: A, C] |
| 99% seqID Fv Structure | None |
| 95-98% seqID Fv Structure | None |
| 100% seqID Structure | 7czd [Fvs: A, C] |
Follow these links to our prediction tools:
| Format | Bispec Mixed Domains (Single domain entry;H) |
| Isotype | na |
| Highest Clinical Trial (Feb '25) | TBC |
| Estimated Status (Feb '25) | TBC |
| Recorded Developmental Technology | TBC |
| INN Year Proposed | 2025 |
| INN Year Recommended | None |
| Companies Involved | TBC |
| Conditions Approved | TBC |
| Conditions Active | TBC |
| Conditions Discontinued | TBC |
| Notes | TBC |
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]
Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]
