Thera-SAbDab

BIMEKIZUMAB

> Structural Summary

Therapeutic	Bimekizumab
Target	IL17A
Heavy Chain	EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYNMAWVRQAPGKGLEWVATITYEGRNTYYRDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCASPPQYYEGSIYRLWFAHWGQGTLVTVSS
Light Chain	AIQLTQSPSSLSASVGDRVTITCRADESVRTLMHWYQQKPGKAPKLLIYLVSNSEIGVPDRFSGSGSGTDFRLTISSLQPEDFATYYCQQTWSDPWTFGQGTKVEIK
100% seqID Fv Structure	8ruu [Fvs: BC, HL]
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

100% seqID Structure	8ruu [Fvs: BC, HL]

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder2
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G1
Highest Clinical Trial (Feb '25)	Approved
Estimated Status (Feb '25)	Active
Recorded Developmental Technology
INN Year Proposed	2013
INN Year Recommended	2014
Companies Involved	UCB
Conditions Approved	Plaque psoriasis
Conditions Active	Ankylosing spondylitis, Psoriatic arthritis, Hidradenitis suppurativa, Ulcerative colitis, Axial spondylarthritis
Conditions Discontinued	Psoriasis, Rheumatoid arthritis
Notes	Fv sequence identical to Galvokimig

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]

Our privacy policy