Therapeutic | Bremzalerbart |
Target | Bet v 1 |
Heavy Chain | QVQLQESGPGLVKPSETLSLTCSVSGGSITNYFWTWIRQSPGKGLEWIGYIYYSGGTNYNPSLKSRVTISIDTSKNQFSLNMNSVTAADTAVYYCAGSYYYGVDVWGQGTTVTVSS |
Light Chain | EIVLTQSPATLSLSPGERATLSCRASQSIKSFLAWYRQKPGQAPRLLIYDASNRPTGIPARFSGSGSGTDFTLTINSLESEDFAVYFCQQRNNWPFTFGPGTKVDIK |
100% seqID Fv Structure | 7mxl [Fvs: AB], 7n0u [Fvs: HL] |
99% seqID Fv Structure | None |
95-98% seqID Fv Structure | None |
100% seqID Structure | 7mxl [Fvs: AB] |
100% seqID Structure | 7n0u [Fvs: HL] |
Follow these links to our prediction tools:
Format | Whole mAb |
Isotype | G4 |
Highest Clinical Trial (Feb '25) | Phase-III |
Estimated Status (Feb '25) | Active |
Recorded Developmental Technology | |
INN Year Proposed | 2022 |
INN Year Recommended | 2023 |
Companies Involved | Regeneron Pharmaceutical |
Conditions Approved | na |
Conditions Active | Allergic rhinitis, Birch pollen allergy |
Conditions Discontinued | na |
Notes | Identical V region sequence to Atisnolerbart |
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]
Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]