Thera-SAbDab

DACLIZUMAB

> Structural Summary

Therapeutic	Daclizumab
Target	IL2RA/CD25
Heavy Chain	QVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYRMHWVRQAPGQGLEWIGYINPSTGYTEYNQKFKDKATITADESTNTAYMELSSLRSEDTAVYYCARGGGVFDYWGQGTLVTVSS
Light Chain	DIQMTQSPSTLSASVGDRVTITCSASSSISYMHWYQQKPGKAPKLLIYTTSNLASGVPARFSGSGSGTEFTLTISSLQPDDFATYYCHQRSTYPLTFGQGTKVEVK
100% seqID Fv Structure	3nfp [Fvs: AB, HL], 3nfs [Fvs: HL]
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

100% seqID Structure	3nfs [Fvs: HL]
100% seqID Structure	3nfp [Fvs: AB, HL]

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder2
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G1
Highest Clinical Trial (Aug '24)	Approved
Estimated Status (Aug '24)	Active
Recorded Developmental Technology	GS Gene Expression System
INN Year Proposed	1994
INN Year Recommended	1998
Companies Involved	AbbVie, Biogen, Dana-Farber Cancer Institute, National Cancer Institute (USA), PDL BioPharma
Conditions Approved	Renal transplant rejection
Conditions Active	Multiple sclerosis
Conditions Discontinued	Asthma, Graft-versus-host disease, Haematological malignancies, Immune-mediated uveitis, Liver transplant rejection, Psoriasis, Tropical spastic paraparesis, Type 1 diabetes mellitus, Ulcerative colitis
Notes	Daclizumab is the new name for Dacliximab (PL78). Biosimilar available

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]

Our privacy policy