| Therapeutic | Ebribafusp |
| Target | C3d |
| Heavy Chain | QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYINWVRQAPGQGLEWMGVINPYSGGTSYNQKFKGRVTMTVDTSTSTAYMELSSLRSEDTAVYFCSSPYWGQGTLVTVSS |
| Light Chain | DVVMTQSPLSLPVTLGQPASISCKSSQSLLDSDGKTYLNWFQQRPGQSPRRLIYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCWQGTHFPRTFGGGTKVEIK |
| 100% seqID Fv Structure | 7ue9 [Fvs: HL] |
| 99% seqID Fv Structure | None |
| 95-98% seqID Fv Structure | None |
| 100% seqID Structure | 7ue9 [Fvs: HL] |
Follow these links to our prediction tools:
| Format | Fusion Protein |
| Isotype | G4 |
| Highest Clinical Trial (Aug '24) | TBC |
| Estimated Status (Aug '24) | Active |
| Recorded Developmental Technology | |
| INN Year Proposed | 2024 |
| INN Year Recommended | None |
| Companies Involved | Q32 Bio |
| Conditions Approved | TBC |
| Conditions Active | TBC |
| Conditions Discontinued | TBC |
| Notes |
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]
Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]
