Thera-SAbDab

RETIFANLIMAB

> Structural Summary

Therapeutic	Retifanlimab
Target	PDCD1/CD279/PD1
Heavy Chain	QVQLVQSGAEVKKPGASVKVSCKASGYSFTSYWMNWVRQAPGQGLEWIGVIHPSDSETWLDQKFKDRVTITVDKSTSTAYMELSSLRSEDTAVYYCAREHYGTSPFAYWGQGTLVTVSS
Light Chain	EIVLTQSPATLSLSPGERATLSCRASESVDNYGMSFMNWFQQKPGQPPKLLIHAASNQGSGVPSRFSGSGSGTDFTLTISSLEPEDFAVYFCQQSKEVPYTFGGGTKVEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder2.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder2
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G4
Highest Clinical Trial (Feb '25)	Approved
Estimated Status (Feb '25)	Active
Recorded Developmental Technology
INN Year Proposed	2019
INN Year Recommended	2020
Companies Involved	MacroGenics, Incyte Corporation, ZAI Lab
Conditions Approved	Merkel cell carcinoma
Conditions Active	Gastic cancers, Oesophageal cancer, Anal cancer, Endometrial cancer, Solid tumours, Colorectal cancer, Acute myeloid leukaemia, Squamous cell cancer, Non-small cell lung cancer, Glioblastoma, Head and neck cancer, Liposarcoma, Pancreatic cancer, Penile cancer, Soft tissue sarcoma
Conditions Discontinued	Haematological malignancies
Notes	Chimeric: Mouse/Human

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]

Our privacy policy