| Therapeutic | Tralokinumab |
| Target | IL13 |
| Heavy Chain | QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGLSWVRQAPGQGLEWMGWISANNGDTNYGQEFQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDSSSSWARWFFDLWGRGTLVTVSS |
| Light Chain | SYVLTQPPSVSVAPGKTARITCGGNIIGSKLVHWYQQKPGQAPVLVIYDDGDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDTGSDPVVFGGGTKLTVL |
| 100% seqID Fv Structure | 5l6y [Fvs: HL], 8blq [Fvs: EC] |
| 99% seqID Fv Structure | None |
| 95-98% seqID Fv Structure | None |
| 100% seqID Structure | 5l6y [Fvs: HL] |
| 100% seqID Structure | 8blq [Fvs: EC] |
Follow these links to our prediction tools:
| Format | Whole mAb |
| Isotype | G4 |
| Highest Clinical Trial (Feb '25) | Approved |
| Estimated Status (Feb '25) | Active |
| Recorded Developmental Technology | |
| INN Year Proposed | 2009 |
| INN Year Recommended | 2010 |
| Companies Involved | Cambridge Antibody Technology, Icahn School of Medicine at Mount Sinai, LEO Pharma, MedImmune |
| Conditions Approved | Atopic dermatitis |
| Conditions Active | Alopecia areata |
| Conditions Discontinued | Asthma, Chronic obstructive pulmonary disease, Idiopathic pulmonary fibrosis, Ulcerative colitis |
| Notes |
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]
Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]
