Thera-SAbDab

GOLIMUMAB

> Structural Summary

Therapeutic	Golimumab
Target	TNFA
Heavy Chain	QVQLVESGGGVVQPGRSLRLSCAASGFIFSSYAMHWVRQAPGNGLEWVAFMSYDGSNKKYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRGIAAGGNYYYYGMDVWGQGTTVTVSS
Light Chain	EIVLTQSPATLSLSPGERATLSCRASQSVYSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPPFTFGPGTKVDIK
100% seqID Fv Structure	5yoy [Fvs: GD, HE, IF, PM, QN, RO]
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

100% seqID Structure	5yoy [Fvs: GD, HE, IF, PM, QN, RO]

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G1
Highest Clinical Trial (June '19)	Approved
Estimated Status (June '19)	Active
Recorded Developmental Technology	Medarex UltiMAb Mouse
INN Year Proposed	2004
INN Year Recommended	2005
Companies Involved	Centocor, Centocor Ortho Biotech, Janssen Biotech, Merck & Co, Mitsubishi Tanabe Pharma Corporation, Medarex
Conditions Approved	Ankylosing spondylitis, Juvenile rheumatoid arthritis, Non-radiographic axial spondyloarthritis, Psoriatic arthritis, Rheumatoid arthritis, Ulcerative colitis
Conditions Active	Hearing disorders, Type 1 diabetes mellitus
Conditions Discontinued	Asthma, Cardiovascular disorders, Sarcoidosis, Uveitis
Notes

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]