Therapeutic | Brentuximab |
Target | TNFRSF8 |
Heavy Chain | QIQLQQSGPEVVKPGASVKISCKASGYTFTDYYITWVKQKPGQGLEWIGWIYPGSGNTKYNEKFKGKATLTVDTSSSTAFMQLSSLTSEDTAVYFCANYGNYWFAYWGQGTQVTVSA |
Light Chain | DIVLTQSPASLAVSLGQRATISCKASQSVDFDGDSYMNWYQQKPGQPPKVLIYAASNLESGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQSNEDPWTFGGGTKLEIK |
100% seqID Fv Structure | None |
99% seqID Fv Structure | None |
95-98% seqID Fv Structure | None |
Follow these links to our prediction tools:
Format | Whole mAb ADC |
Isotype | G1 |
Highest Clinical Trial (Aug '22) | Approved |
Estimated Status (Aug '22) | Active |
Recorded Developmental Technology | na |
INN Year Proposed | 2010 |
INN Year Recommended | 2011 |
Companies Involved | Bristol-Myers Squibb, Celgene Corporation, Dana-Farber Cancer Institute, Fondazione Italiana Linfomi, Fox Chase Cancer Center, Immune Tolerance Network, Lymphoma Academic Research Organisation, Massachusetts General Hospital, National Cancer Institute (USA), National Institute of Allergy and Infectious Diseases, Seattle Genetics, Stanford University, Takeda, Takeda Oncology, UNC Lineberger Comprehensive Cancer Center, Washington University School of Medicine |
Conditions Approved | Anaplastic large cell lymphoma, Cutaneous T-cell lymphoma, Hodgkin's disease, Mycosis fungoides, T-cell lymphoma |
Conditions Active | Adult T-cell leukaemia-lymphoma, Diffuse large B cell lymphoma, Germ cell and embryonal neoplasms, Mastocytosis, Mesothelioma, Non-Hodgkin's lymphoma, Peripheral T-cell lymphoma, Sezary syndrome, Diffuse scleroderma |
Conditions Discontinued | Graft-versus-host disease, Leukaemia, Multiple myeloma, Solid tumours, Systemic lupus erythematosus |
Notes |
SAbDab papers
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]
Thera-SAbDab paper
Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]