Thera-SAbDab

BRODALUMAB

> Structural Summary

Therapeutic	Brodalumab
Target	IL17RA
Heavy Chain	QVQLVQSGAEVKKPGASVKVSCKASGYTFTRYGISWVRQAPGQGLEWMGWISTYSGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARRQLYFDYWGQGTLVTVSS
Light Chain	EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWFQQKPGQAPRPLIYDASTRATGVPARFSGSGSGTDFTLTISSLQSEDFAVYYCQQYDNWPLTFGGGTKVEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder2.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder2
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G2
Highest Clinical Trial (Feb '25)	Approved
Estimated Status (Feb '25)	Active
Recorded Developmental Technology	Abgenix XenoMouse
INN Year Proposed	2011
INN Year Recommended	2012
Companies Involved	Amgen, AstraZeneca, Bausch Health Companies, Kyowa Hakko Kirin, LEO Pharma
Conditions Approved	Erythrodermic psoriasis, Plaque psoriasis, Psoriatic arthritis, Pustular psoriasis, Psoriasis
Conditions Active	Spondylarthritis, Systemic scleroderma
Conditions Discontinued	Asthma, Crohn's disease, Rheumatoid arthritis
Notes

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]

Our privacy policy