Thera-SAbDab

FIBATUZUMAB

> Structural Summary

Therapeutic	Fibatuzumab
Target	EPHA3
Heavy Chain	QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYWMNWVRQAPGQGLEWMGDIYPGSGNTNYDEKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGGYYEDFDSWGQGTTVTVSS
Light Chain	DIQMTQSPSFLSASVGDRVTITCRASQGIISYLAWYQQKPEKAPKRLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCGQYANYPYTFGQGTKLEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G1
Highest Clinical Trial (June '19)	Phase-II
Estimated Status (June '19)	Active
Recorded Developmental Technology	POTELLIGENT Technology;Humaneering Technology
INN Year Proposed	2015
INN Year Recommended	2017
Companies Involved	Ludwig Institute for Cancer Research, Humanigen, Olivia Newton-John Cancer Research Institute
Conditions Approved	na
Conditions Active	Acute myeloid leukaemia, Myelodysplastic syndromes, Myelofibrosis, Glioblastoma
Conditions Discontinued	na
Notes	Fibatuzumab and Ifabotuzumab are the same mAb

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]