Thera-SAbDab

ZENOCUTUZUMAB

>   Structural Summary
TherapeuticZenocutuzumab
Target 1ERBB3
Heavy Chain 1QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARDHGSRHFWSYWGFDYWGQGTLVTVSS
Light Chain 1DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPPTFGQGTKVEIK
100% seqID Fv 1 Structure5o4o [Fvs: BA], 5o7p [Fvs: BA]
99% seqID Fv 1 StructureNone
95-98% seqID Fv 1 StructureNone
Target 2ERBB2
Heavy Chain 2QVQLVQSGAEVKKPGASVKLSCKASGYTFTAYYINWVRQAPGQGLEWIGRIYPGSGYTSYAQKFQGRATLTADESTSTAYMELSSLRSEDTAVYFCARPPVYYDSAWFAYWGQGTLVTVSS
Light Chain 2DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPPTFGQGTKVEIK
100% seqID Fv 2 Structure5o4g [Fvs: BA]
99% seqID Fv 2 StructureNone
95-98% seqID Fv 2 StructureNone
>   Metadata
FormatBispecific mAb
IsotypeG1;G1
Highest Clinical Trial (October '21)Phase-II
Estimated Status (October '21)Active
Recorded Developmental TechnologyGlymaxX Technology
INN Year Proposed2017
INN Year Recommended2018
Companies InvolvedMerus
Conditions Approvedna
Conditions ActiveBreast cancer, Colorectal cancer, Gastric cancer, Non-small cell lung cancer
Conditions DiscontinuedEndometrial cancer, Ovarian cancer
Notes

SAbDab papers

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

Dunbar, J., Krawczyk, K. et al. (2014) SAbDab: the Structural Antibody Database. Nucleic Acids Res. 42(D1):D1140-D1146 [link]

Thera-SAbDab paper

Raybould, M.I.J., Marks, C. et al (2020) Thera-SAbDab: the Therapeutic Structural Antibody Database. Nucleic Acids Res. 48(D1):D383-D388. [link]

Our privacy policy